PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_07620.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 547aa    MW: 62020.4 Da    PI: 6.5102
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_07620.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.8e-5661341129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              +ppGfrFhPtdeelv +yLk+k++g+++el e+i+e+d+yk+ePwdLp k  + +++ ew+fFs+rd+ky++g+r+nratk+gyWk
  Rsa1.0_07620.1_g00001.1   6 MPPGFRFHPTDEELVIYYLKRKINGRTIEL-EIIPEIDLYKCEPWDLPgKsLLPSKDLEWFFFSPRDRKYPNGSRTNRATKAGYWK 90 
                              79****************************.99***************6434555777**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              atgkd++v+s ++++vg+kktLv+y+grap+g++tdWvmheyrle
  Rsa1.0_07620.1_g00001.1  91 ATGKDRKVTS-HSRTVGTKKTLVYYRGRAPHGSRTDWVMHEYRLE 134
                              **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-644156IPR003441NAC domain
PROSITE profilePS5100561.0256156IPR003441NAC domain
PfamPF023651.8E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MAPVSMPPGF RFHPTDEELV IYYLKRKING RTIELEIIPE IDLYKCEPWD LPGKSLLPSK  60
DLEWFFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVTS HSRTVGTKKT LVYYRGRAPH  120
GSRTDWVMHE YRLEEQECDS KSGIQDAYAL CRVFKKSALA NKLEEKHHGM KKKKPTSNSE  180
QSTSSTCLYS DGMYENLENS GYPVSPDHGL TQLGNISSSD METIENKWSH FLSHDTSFNF  240
PAQSQFCSQY GTITYPPSQA EIAFECARLK NRMLPPAPPL HVEDLAHTEN LGTNVVNDTD  300
QMLSKIIELA QASHEPYNSL GSWEFASASG NFLGDVCYPG EKASSSGVGA NMKAVDMQVH  360
DGRLKEERIV ENLRWVGISS KELEKSFIEE HSTVVPIEDI WSYRRGSHEY QDGEGVNNNG  420
DVDDVYTLEF SENELNANNS DKTNNHDHDA TSSPRFEMVN RVEVSHGLFV TTRQVTNTCF  480
QQIVPSQTVI VYINPTGTVN CGHEMKPMDQ KVHVAKQINP RTDSFVSKML GPWRRFAYLL  540
VSFICSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-57116212171NO APICAL MERISTEM PROTEIN
1ut4_B1e-57116212171NO APICAL MERISTEM PROTEIN
1ut7_A1e-57116212171NO APICAL MERISTEM PROTEIN
1ut7_B1e-57116212171NO APICAL MERISTEM PROTEIN
4dul_A1e-57116212171NAC domain-containing protein 19
4dul_B1e-57116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026845e-83CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF12P195e-83AC009513.2 Sequence of BAC F12P19 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618727.10.0PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 86
TrEMBLA0A0D3ANA60.0A0A0D3ANA6_BRAOL; Uncharacterized protein
STRINGBra039745.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101122632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.10.0NAC domain containing protein 28